DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb8

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:373 Identity:110/373 - (29%)
Similarity:190/373 - (50%) Gaps:21/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDK 79
            |.|...|.:...:::|..|:...|:.|...::|:.:||.||||.::...|.|..| .:|...:..
  Rat     9 GSFAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGD-GDVHQGFQT 72

  Fly    80 LLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIK-LADRLKAAWAINDWVL 143
            ||.::.:.....:|..|.|||..|:......:.:...|.::|..|.:. :.|.......||||||
  Rat    73 LLAEVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRINDWVL 137

  Fly   144 DQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVG 208
            ::|...:.:::.|..:.|....|::||.:|||.||.:||:..|:...|..::..:..|.||.:..
  Rat   138 EKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQMMFKHA 202

  Fly   209 RFKMRTSTID----QIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQI-------VLTEMD 262
            :|||  :.:|    |::.||:|...||||::||.::..||..|..: :|.::       .|||..
  Rat   203 KFKM--AHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKAL-TYEKLRAWTNPETLTESK 264

  Fly   263 VHVQLPKFKIDFRMELVETLKSMGIQDLF-NSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSA 326
            |.|..|:.|::...:|...|:|:|:.|.| .:.:|.|.:.::....:|:|.||.|:|::|||..|
  Rat   265 VQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEA 329

  Fly   327 GSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372
             :|:.:.||........ ..|..:.||:|.|  :...:|.|.||...|
  Rat   330 -AATTAVIRNTRSCRIE-PRFCADRPFLFFIWHQKTSSILFCGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 107/367 (29%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 109/371 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.