DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinf1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:386 Identity:101/386 - (26%)
Similarity:177/386 - (45%) Gaps:51/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL-----NLPEDKK 71
            :.:..|...|||.........||:.|||.|...:|.:.:||:..|.:.:..||     |.|:   
  Rat    56 AAVSNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPD--- 117

  Fly    72 NVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAW 136
             :.:.|.:||..:...:|  ....|:|:.....:.|...:...:.|.:......:....|:... 
  Rat   118 -IHSTYKELLASVTAPEK--NFKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRIDLQ- 178

  Fly   137 AINDWVLDQTLDNVKDII--IPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQV 199
            .||:||..|....:....  :||.|    |.:::..|:|||.|.|:||...|..:.|::.:...|
  Rat   179 EINNWVQAQMKGKIARSTREMPSAL----SILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTV 239

  Fly   200 NVNMMSQ---VGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEM 261
            .|.|||.   :.|:.:.:....:|.:||.. .::|::..||.   ::||....||.    .||..
  Rat   240 RVPMMSDPKAILRYGLDSDLNCKIAQLPLT-GSMSIIFFLPL---TVTQNLTMIEE----SLTSE 296

  Fly   262 DVH------------VQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHK 314
            .||            :.:||.|:.:..::..:|:.|.:|.|| .|.|.|.:..:. .:::||.|:
  Rat   297 FVHDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLF-ESPDFSKITGKP-VKLTQVEHR 359

  Fly   315 AFIEIDEEG-GSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDN--IYFRGRVVDP 372
            |..|.:||| |::.:....|:|     .|..:.:.:|.||:|::||.|.  :.|.||::||
  Rat   360 AAFEWNEEGAGTSSNPDLQPVR-----LTFPLDYHLNRPFIFVLRDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 98/377 (26%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 99/384 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.