DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:378 Identity:110/378 - (29%)
Similarity:191/378 - (50%) Gaps:28/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKLL 81
            ||.:|:.:..:.:...||..||..:...::|:.:||.|:||.:|...|:. :..:::.:.:..|.
Mouse    11 FTLELFHTLKESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHF-DSVEDIHSCFQSLT 74

  Fly    82 TKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLK-AAWAINDWVLDQ 145
            .::.:......|.|||||:..:|......:.....|.:.|:..|:......: |...||.||..|
Mouse    75 AEVSKLGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDARKEINQWVKGQ 139

  Fly   146 TLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRF 210
            |...:.:::....:......|::||.:|||.|:.:|....|....|.::|.....|.||.|..:|
Mouse   140 TEGKIPELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKKDTKTVKMMYQKKKF 204

  Fly   211 KMR--TSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEM------------ 261
            ...  :....:::|:|:....|||||:||:|....:.....||.  |:.|.::            
Mouse   205 PFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEE--QLTLGKLHEWTKHENLRNI 267

  Fly   262 DVHVQLPKFKIDFRMELVETLKSMGIQDLFNS-SSDISVLLNQSGTR---ISQVVHKAFIEIDEE 322
            ||||:||:||::....|...|..:|:||||:| .:|:|   ..||:|   :|::|||:|::::|:
Mouse   268 DVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGKADLS---GMSGSRDLFVSKIVHKSFVDVNEQ 329

  Fly   323 GGSAGSASASPIRGLSD-YATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDP 372
            |..|.:|:...|:.|.: ..|....|||:.||:|.||.:.  |:.|.|||..|
Mouse   330 GTEAAAATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFGRVCSP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 107/373 (29%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 109/376 (29%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 13/29 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.