DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb10

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:398 Identity:97/398 - (24%)
Similarity:195/398 - (48%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNL---------PED 69
            :.||..:..:...:..:..||..||..:...::|:.:|..|.||.::...|:.         |:.
  Rat     8 INQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDS 72

  Fly    70 KK------------NVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAE 122
            :|            .:.:.:..|..|:.:.....:|.:|||::|.:|...:.:|.:.:..:|.||
  Rat    73 EKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAE 137

  Fly   123 AEAIKLADRL-KAAWAINDWVLDQTLDNVKDIIIPSDLTPDESA-VMINAAFFKGYWKTRFDKMN 185
            .:::...:.. :....||.||..||...:.: ::|.|...:::. |::||.:|||.|:.:|...|
  Rat   138 PQSVNFVEASGQIRKEINSWVGSQTGGKIPN-LLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQN 201

  Fly   186 TKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQI----IELPFAYSNLSMVIVLPKDNGSLTQA 246
            |..:.|.::|:....|.|||.  :..::...|:::    ::|.:.....|::::||::...|.|.
  Rat   202 TTERPFRINKTTSKPVQMMSM--KQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEVEGLKQL 264

  Fly   247 EATIESYPQI-------VLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQ 303
            |..| :|.::       ::...:|.:.|||||::...:|...|:.||:.|.|| ..::.|.:.::
  Rat   265 ERAI-TYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTSE 328

  Fly   304 SGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNS--PFVFMIRDD--DNIY 364
            ....:|.|.||.|:||:|||..|.:.:.|.:    ::.....:..:|:  ||:|:||.:  :.|.
  Rat   329 RNLFLSNVFHKTFLEINEEGTEAAAGTGSEV----NFRIKAPSIELNADHPFLFLIRHNVTNTIL 389

  Fly   365 FRGRVVDP 372
            |.||...|
  Rat   390 FYGRFYSP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 95/391 (24%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 96/396 (24%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.