DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA11

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:382 Identity:103/382 - (26%)
Similarity:181/382 - (47%) Gaps:31/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKN 72
            |..:..|..:||:....| ...||..||:.:...::::.:||..||:..:...|  ||.| .:.:
Human    51 TPTITNFALRLYKELAAD-APGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEAD 114

  Fly    73 VATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWA 137
            :...:..||..|........|.:.|.||:::.:...:.|...:.:.:.|.|.:....|.:.....
Human   115 IHQGFRSLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQ 179

  Fly   138 INDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNT-KPKVFYVSKSYQVNV 201
            |||::..||...|.|.:  .:.:.|...|:.|..|||..||..|.:..| |.:.|:|.:...:.|
Human   180 INDYLRRQTYGQVVDCL--PEFSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQV 242

  Fly   202 NMMSQ--VGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TIESYPQIVLT 259
            .||.|  :.||.........::::.:. .|...::||| |.|.:.|.||     |:..:.|::|.
Human   243 PMMHQKEMHRFLYDQDLACTVLQIEYR-GNALALLVLP-DPGKMKQVEAALQPQTLRKWGQLLLP 305

  Fly   260 E-MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEG 323
            . :|:|  ||:|.|.....|.:.|..:|:.::.|..:|.|.:..|....||:|.|||.:::.|:|
Human   306 SLLDLH--LPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQLNKTISKVSHKAMVDMSEKG 368

  Fly   324 GSAGSASASPIRGLSDYATSVVTFT-----VNSPFVFMIRD--DDNIYFRGRVVDPL 373
            ..||:||     ||.....|:.|.:     .|.||:.::.:  ..::.|.|:||:|:
Human   369 TEAGAAS-----GLLSQPPSLNTMSDPHAHFNRPFLLLLWEVTTQSLLFLGKVVNPV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 99/371 (27%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 99/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.