DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina3n

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:384 Identity:102/384 - (26%)
Similarity:177/384 - (46%) Gaps:30/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-D 69
            |...|:...|...||:.....|...|::.|||.:...::::.:||.||:..|:...|  ||.| .
  Rat    45 LTLASINTDFAFSLYKKLALRNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFNLTETP 109

  Fly    70 KKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKA 134
            :..:...:..||.:|.:.:....:...|.||:.:.:.|...:.:.....::|||.........:|
  Rat   110 ETEIHRGFGHLLQRLSQPRDEIQISTGNALFIEKRLQVLAEFQEKAKALYQAEAFTADFQQSREA 174

  Fly   135 AWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQV 199
            ...|||:|..||...::.:|  ::|....|.|::|..:|||.||..||..:|....||..|...|
  Rat   175 KKLINDYVSKQTQGKIQGLI--TNLAKKTSMVLVNYIYFKGKWKVPFDPRDTFQSEFYSGKRRPV 237

  Fly   200 NVNMMSQVGRFKMRTSTI----DQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TI 250
            .|.||      |:...|.    |:     ::||.:. .|.|.:.:|| |.|.:.|.||     |:
  Rat   238 KVPMM------KLEDLTTPYVRDEELNCTVVELKYT-GNASALFILP-DQGKMQQVEASLQPETL 294

  Fly   251 ESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKA 315
            ..:...:...|...:.||||.|.....|.:.|..:||:::|::.:|:|.:.......:|||||||
  Rat   295 RRWKDSLRPSMIDELYLPKFSISADYNLEDVLPELGIKEVFSTQADLSGITGDKDLMVSQVVHKA 359

  Fly   316 FIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIY--FRGRVVDP 372
            .:::.|.|..|.:|:......:|.....:: ...:.||:.:|.|.:...  |..::.:|
  Rat   360 VLDVAETGTEAAAATGVKFVPMSAKLDPLI-IAFDRPFLMIISDTETAIAPFLAKIFNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 99/371 (27%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 102/384 (27%)
RCL 367..394 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.