DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:376 Identity:107/376 - (28%)
Similarity:185/376 - (49%) Gaps:21/376 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL-----NLPEDK 70
            :|.|..|...|||..:..:...||..||:.:....:|:.:|:.|:|..::...|     .:||  
  Rat    45 SSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPE-- 107

  Fly    71 KNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAA 135
            .::...:..||..|.|......|:..|.||||:.:.:.:::.:.|..::.:||.::..||..:|.
  Rat   108 ADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAK 172

  Fly   136 WAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVN 200
            ..|||:|...|...:.|::  ..|..|....::|..||||.||..|:..:|:...|:|.||..|.
  Rat   173 KVINDYVEKGTQGKIVDLM--KQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVK 235

  Fly   201 VNMMSQVGRFKMR-TSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATI--ESYPQIVLTEM- 261
            |.||:::|.|.|. .||:...:.:.....|.:.:.:|| |:|.:...|.|:  :...:.:|... 
  Rat   236 VPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLP-DDGKMQHLEQTLTKDLISRFLLNRQT 299

  Fly   262 -DVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEEGGS 325
             ...:..||..|.....|...|.|:||..:||:.:|:|.:...:..::||.||||.:.:||.|..
  Rat   300 RSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTE 364

  Fly   326 AGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDPLK 374
            |  |.|:.:..:.......|.|  :.||:|||.:.:  :..|.|:|:||.:
  Rat   365 A--AGATVVEAVPMSLPPQVKF--DHPFIFMIVESETQSPLFVGKVIDPTR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 102/364 (28%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 102/365 (28%)
RCL 367..386 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.