DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina4

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:407 Identity:100/407 - (24%)
Similarity:173/407 - (42%) Gaps:91/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANEL-------RTALNLPEDKKNVA 74
            |..:||......|.:.||..|||.:.:.::::..||.|:|..::       .|.|:|||..:...
  Rat    55 FAFRLYHLIASQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKLSLPEIHEGFR 119

  Fly    75 TIYDKL---LTKLERGKKVAILHLANRLFVNETI-GVNKRYN-KLVNKHFRAEAEAIKLADRLKA 134
            ::...:   .|:.:.....|::...|...::|.: .:...|| |:::.:||.:..|::|      
  Rat   120 SLQHTIARPFTEPQISVGSALILSQNLQILSEFVSAIETSYNSKVLHANFRDKEAAVQL------ 178

  Fly   135 AWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQV 199
               ||::|...|...:|:::  |||:||...|::|..||:|.||..|.........|||.::..|
  Rat   179 ---INNYVKQNTQGKIKNLV--SDLSPDVKMVLVNYIFFQGLWKKPFPSSRVSTSDFYVDENTVV 238

  Fly   200 NVNMMSQ----------------VGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEA 248
            .:.||.|                |.|...|...:              ...:|| |.|.:.:.|.
  Rat   239 KIPMMLQDKEDHWYLEDRRVPCTVLRMDYRGDAV--------------AFFILP-DQGKMNEVEQ 288

  Fly   249 TIES---------------YPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDIS 298
            .:..               |.:::|       |||||.|....||.|.|..:|.||||..:::.|
  Rat   289 VLSPGMLLRWKRLLQNRFFYRKLIL-------QLPKFSISNSYELDEILPDLGFQDLFTPNANFS 346

  Fly   299 VLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVT------FTVNSPFVFMI 357
            .:..:....:|:|.||..::::|.|..|.:|:.|       :||....      ...|.||:.::
  Rat   347 NISKKEKLYLSKVFHKTVLDVNEVGTKAAAATGS-------FATFFSAQPKKRYLIFNRPFLVIL 404

  Fly   358 --RDDDNIYFRGRVVDP 372
              ....:|.|.|:||:|
  Rat   405 YSTSSQDILFMGKVVNP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 97/402 (24%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 97/402 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.