DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb10

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:375 Identity:85/375 - (22%)
Similarity:159/375 - (42%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MILMGADGNTANELRTAL---------NLPEDKK------------NVATIYDKLLTKLERGKKV 90
            |:.:|..|.||:::...|         :.|:.:|            .:.:.:..|..::.:....
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    91 AILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL-KAAWAINDWVLDQTLDNVKDII 154
            .:|..|||::..:|...:.:|.:.:..:|.||.:::...:.. :....||.||..||...:.:::
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLL 130

  Fly   155 IPSDLTPDESA------VMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMR 213
                  ||:|.      |::||.:|||.|:.:|...:|..:.|.|:|:....|.|||.  :..::
Mouse   131 ------PDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSM--KQSLQ 187

  Fly   214 TSTID--QIIELPFAYSN--LSMVIVLPKDNGSLTQAEATIESYPQI-------VLTEMDVHVQL 267
            ...|:  |.|.|...|.|  ||::::||:....|.|.|..| :|.::       ::...:|.:.|
Mouse   188 VFHIEELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAI-TYEKLDKWTSADMMDTYEVQLYL 251

  Fly   268 PKFKIDFRMELVETLKSMGIQDLFNSSSD-------ISVLLN--QSGTRIS-------------- 309
            ||||::...:|...|:.......::..::       .|..|:  |:|..:|              
Mouse   252 PKFKMEESYDLKSALRGQKFSGPYSKENNEDHLPHIYSATLDNQQNGHPVSPRHVFGNGKRKHST 316

  Fly   310 --------QVVHKAFIEIDEEGGSAGSASASPIR-GLSDYATSVVTFTVN 350
                    .::....::|.|....|.|...|||. ..:|..|| .|.|||
Mouse   317 VSGRCDCKSLIQTFVVDIVENSALATSLLISPINSSCADSGTS-STLTVN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 85/375 (23%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 66/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.