DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb13

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:387 Identity:106/387 - (27%)
Similarity:180/387 - (46%) Gaps:37/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLP------------- 67
            ||...|::. |......|:..||:.:...:.||::|..|.||:||:..|...             
Mouse    10 QFLFDLFKE-LNKTNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEE 73

  Fly    68 --EDKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLAD 130
              |.::.:......|||::.:......|.::||||..:|....::|...|.|::.|..|.:   |
Mouse    74 EIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPV---D 135

  Fly   131 RLKAA----WAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVF 191
            .:.||    ..||.||..||...|||:.....|......|:||..:|||.|...|.|.:||.:.|
Mouse   136 FVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDF 200

  Fly   192 YVSKSYQVNVNMMSQVGRFKMRTSTID---QIIELPFAYSNLSMVIVLPKDNGSLTQ------AE 247
            :::|:....|.||:....|.. |...|   :|:.:|:..:::||.::||.|...|.:      .|
Mouse   201 WLNKNLSKPVQMMALCSSFNF-TFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPE 264

  Fly   248 ATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVV 312
            ..:|......|.:..|.::||:.:::...:|...|:::||...|:..:|.|.:..:||......:
Mouse   265 KLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQNFL 329

  Fly   313 HKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372
            |::|:.:.|||..|.:.:...::..|  |.|......|.||:|.|  |:.|:|.|.|:...|
Mouse   330 HRSFLVVTEEGVEATAGTGVGLKVSS--AASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 105/382 (27%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 105/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.