DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina3g

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:386 Identity:109/386 - (28%)
Similarity:185/386 - (47%) Gaps:26/386 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-D 69
            ||:::.  .|...|||..:..|...|::.||..:...::::.:||..||..|:...|  ||.| .
Mouse    37 LVSSNT--DFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETP 99

  Fly    70 KKNVATIYDKLLTKLER-GKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLK 133
            :.::...:..||..|.: |.:|.| ...:.||:.:.:.:...:.:.....::|||........||
Mouse   100 EPDIHQGFRYLLDLLSQPGNQVQI-STGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLK 163

  Fly   134 AAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQ 198
            |...|||:|.:.|...:|.:|  |.|......|::|..:|||.||..||..:|....||:.:...
Mouse   164 ATKLINDYVSNHTQGKIKQLI--SGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKRS 226

  Fly   199 VNVNMMSQVGRFK---MRTSTID-QIIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TIESYP 254
            |.|:|| :.|...   .|...:. .::||.:. .|.|.:.:|| |.|.:.|.||     |:..:.
Mouse   227 VIVSMM-KTGYLTTPYFRDEELSCTVVELKYT-GNASAMFILP-DQGRMQQVEASLQPETLRKWK 288

  Fly   255 QIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEI 319
            ..:...|...::||||.|.....|...|..:||:::|::.:|:|.:......|:|||||||.:::
Mouse   289 NSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDV 353

  Fly   320 DEEGGSAGSASASPIRGLSDYAT-SVVTFTVNSPFVFMIRDDDN--IYFRGRVVDPLKKSN 377
            .|:|..|  |:|:.:.|:...|. ..:....|.||:.:|.|...  ..|..:|.:|.:..|
Mouse   354 AEKGTEA--AAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKAHIALFMAKVTNPERSEN 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 104/368 (28%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 104/368 (28%)
RCL 357..382 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.