DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinb9f

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_899020.1 Gene:Serpinb9f / 20709 MGIID:894671 Length:377 Species:Mus musculus


Alignment Length:382 Identity:111/382 - (29%)
Similarity:184/382 - (48%) Gaps:37/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDK 79
            |.|...|.:...|||...|:..||:.:...::|:|:||.|:||.::..||:|..| ::|...:..
Mouse     9 GTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPD-EDVHQGFQL 72

  Fly    80 LLTKL-ERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAA----WAIN 139
            ||..| ::..:...|.:||||||..|..:...:.:...|.:.:|.|.:..|   |||    ..||
Mouse    73 LLHNLNKQNNQKYCLRMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFA---KAAEESRQHIN 134

  Fly   140 DWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMM 204
            .||..||...:.|::....:......::.||.:|.|.|..||:|..||...|.::|.....|.||
Mouse   135 MWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMM 199

  Fly   205 SQVGRFKMRTSTI---------DQIIELPFAYSNLSMVIVLP-------KDNGSLTQAEATIESY 253
                   .|..|:         .|::.:|:...:|:.|::||       |...:||..:.|..:.
Mouse   200 -------WREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTK 257

  Fly   254 PQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFI 317
            |:. :...:.||.||||::....::...|:.:||.::|: |.:|:|.:..:....:|:.|||..:
Mouse   258 PEF-MNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVV 321

  Fly   318 EIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            |::|||..|.:|||.....|. ......||..:.||:|.|...  ::|.|.||...|
Mouse   322 EVNEEGTEAAAASAVEFIFLC-LGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 108/376 (29%)
Serpinb9fNP_899020.1 SERPIN 4..377 CDD:294093 110/380 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.