DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina1d

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_033272.1 Gene:Serpina1d / 20703 MGIID:891968 Length:413 Species:Mus musculus


Alignment Length:374 Identity:104/374 - (27%)
Similarity:182/374 - (48%) Gaps:20/374 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKNVAT 75
            ||.|..:|||..:..:...||..||:.:....:|:.:|:.|:|..::...|  ||.: .:.::..
Mouse    48 LGDFALRLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHK 112

  Fly    76 IYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAIND 140
            .:..||..|.|......|...|.||||..:.:.:::.:....|::||..::..|:..:|...|||
Mouse   113 SFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVIND 177

  Fly   141 WVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMS 205
            :|...|...:.:.:  ..|..|....:.|...|||.||..||..||:...|:|.:|..|.|.||:
Mouse   178 FVEKGTQGKIVEAV--KKLDQDTVFALANYILFKGKWKQPFDPENTEEAEFHVDESTTVKVPMMT 240

  Fly   206 QVGRFKMRTSTI--DQIIELPFAYSNLSMVIVLPKDNGSLTQAEATI--ESYPQIVLT--EMDVH 264
            ..|...:...::  ..::.:.:| .|.:.|.:|| |:|.:...|.|:  |...|.:|.  ..|..
Mouse   241 LSGMLDVHHCSMLSSWVLLMDYA-GNTTAVFLLP-DDGKMQHLEQTLNKELISQFLLNRRRSDAQ 303

  Fly   265 VQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSG-TRISQVVHKAFIEIDEEGGSAGS 328
            :.:|:..|.....|...:..:||..:||:.:|:|.:..::. .::|:.||||.:.|||.|..|.:
Mouse   304 IHIPRLSISGNYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSKAVHKAVLTIDETGTEAAA 368

  Fly   329 ASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDPLKK 375
            |:...:...|  ...:|.|  :.||:|:|.::  .:..|.|:||||..|
Mouse   369 ATVLQVATYS--MPPIVRF--DHPFLFIIFEEHTQSPIFVGKVVDPTHK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 97/364 (27%)
Serpina1dNP_033272.1 SERPIN 53..410 CDD:214513 98/364 (27%)
RCL 368..387 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.