DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina1a

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:373 Identity:103/373 - (27%)
Similarity:177/373 - (47%) Gaps:18/373 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKNVAT 75
            ||.|...|||..:..:...||..||:.:....:|:.:|:.|:|..::...|  ||.: .:.::..
Mouse    71 LGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHK 135

  Fly    76 IYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAIND 140
            .:..||..|.|......|...|.||||..:.:.:::.:....|::||..::..|:..:|...|||
Mouse   136 SFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVIND 200

  Fly   141 WVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMS 205
            :|...|...:.:.:  ..|..|....:.|...|||.||..||..||:...|:|.:|..|.|.||:
Mouse   201 FVEKGTQGKIAEAV--KKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMT 263

  Fly   206 QVGRFKM-RTSTIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATI--ESYPQIVLTEMD--VHV 265
            ..|...: ..||:...:.|.....|.:.|.:|| |:|.:...|.|:  |...:.:|....  ..:
Mouse   264 LSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLP-DDGKMQHLEQTLSKELISKFLLNRRRRLAQI 327

  Fly   266 QLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSG-TRISQVVHKAFIEIDEEGGSAGSA 329
            ..|:..|.....|...:..:||..:||:.:|:|.:..::. .::||.||||.:.|||.|..|.:.
Mouse   328 HFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAV 392

  Fly   330 SASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDPLKK 375
            :...:..:|  ...::.|  :.||:|:|.::  .:..|.|:||||..|
Mouse   393 TVLQMVPMS--MPPILRF--DHPFLFIIFEEHTQSPIFLGKVVDPTHK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 96/363 (26%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 97/363 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.