DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINB1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:392 Identity:120/392 - (30%)
Similarity:189/392 - (48%) Gaps:57/392 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKL 80
            :|...|:.:..::|...||..||..:...|:|:.:|..||||.:|....:. ...:.|.:.:..|
Human    10 RFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF-NTVEEVHSRFQSL 73

  Fly    81 LTKLERGKKVAILHLANRLFVNET--------IGVNKRYN-KLVNKHFRAEAEAIKLADRLKAAW 136
            ...:.:.....||.|||||:..:|        :...|.|. .|.:..|:..:|        .|..
Human    74 NADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASE--------DARK 130

  Fly   137 AINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNV 201
            .||.||..||...:.:::....:......|::||.:|||.||.:|.|..|....|.::|..:..|
Human   131 TINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTV 195

  Fly   202 NMMSQVGRF--------KMRTSTIDQIIELPFAYSNLSMVIVLPKD----NGSLTQAE--ATIES 252
            .||.|..:|        |.|      ::|||:....|||||:||.|    :..|.:.|  .|:|.
Human   196 KMMYQKKKFAYGYIEDLKCR------VLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEK 254

  Fly   253 YPQIVLTE----MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSS-SDISVLLNQSGTR---IS 309
            ..:....|    ::|:|.||:||::....|...|..:|:||||||| :|:|   ..||.|   ||
Human   255 LHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLS---GMSGARDIFIS 316

  Fly   310 QVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSV--VTFTVNSPFVFMIRDDD--NIYFRGRVV 370
            ::|||:|:|::|||..|.:|:|    |::.:...:  ..||.:.||:|.||.:.  :|.|.||..
Human   317 KIVHKSFVEVNEEGTEAAAATA----GIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFS 377

  Fly   371 DP 372
            .|
Human   378 SP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 118/387 (30%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 119/390 (31%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.