DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpine1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:377 Identity:90/377 - (23%)
Similarity:181/377 - (48%) Gaps:33/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKLL 81
            |..::::..:|.:|..|::.||..|...::|:.|...|.|..:::.|:....::|..|....:|.
Mouse    38 FGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLS 102

  Fly    82 TKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQT 146
            .:|........:..|:.:||...:.:.:.:.....|.|:...:.:..::..:|.:.|||||...|
Mouse   103 KELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHT 167

  Fly   147 LDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFK 211
            ...:.|::....:......|::||.:|.|.|||.|.:.:|..::|:.|....|:|.||:|..:|.
Mouse   168 KGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFN 232

  Fly   212 MRTSTID-----QIIELPFAYSNLSMVIVLPKDN----GSLT---------QAEATIESYPQIVL 258
            ....|..     .::|||:....|||.|..|.:.    .:||         |.:..:...|::::
Mouse   233 YTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLI 297

  Fly   259 TEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSS-SDISVLLNQSGTRISQVVHKAFIEIDEE 322
                    ||||.::..::|...|:.:|:.|:|::: :|.:.|.:|....::|.:.|..||::|.
Mouse   298 --------LPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQEQLSVAQALQKVRIEVNES 354

  Fly   323 GGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDP 372
            |..|.|::|..|..    ..:.....::..|:|::|.:  :.|.|.|:|::|
Mouse   355 GTVASSSTAFVISA----RMAPTEMVIDRSFLFVVRHNPTETILFMGQVMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 88/372 (24%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 89/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.