DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpinh1

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:364 Identity:90/364 - (24%)
Similarity:172/364 - (47%) Gaps:20/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDK-KNVATIYDKLLTKL 84
            ||::..:|....||:.|||.|...:.::.:|....||::.:..|:..:.: :.|.|...:||..|
Mouse    53 LYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRSL 117

  Fly    85 ERG-KKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLD 148
            ... .:.....|.:||:...::.....:.:...:|:..|...|...|:..|..:||:|. .||.|
Mouse   118 SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWA-SQTTD 181

  Fly   149 NVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMR 213
            . |...:..|:...:.|:::||.|||.:|..:|.......:.|.|::||.|.|.||.:.|.:...
Mouse   182 G-KLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYY 245

  Fly   214 TSTID--QIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQI-----VLTEMDVHVQLPKFK 271
            ....:  |::|:|.|:...|::|::|.....|.:.|..: :..|:     .:.:..|.:.|||..
Mouse   246 DDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLL-TKEQLKAWMGKMQKKAVAISLPKGV 309

  Fly   272 IDFRMELVETLKSMGIQDLFN-SSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIR 335
            ::...:|.:.|..:|:.:..: :.:|:|.:..:....::.|.|....|.|.|    |:.....|.
Mouse   310 VEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTE----GNPFDQDIY 370

  Fly   336 GLSDYATSVVTFTVNSPFVFMIRDDD--NIYFRGRVVDP 372
            |..: ..|...|..:.||:|::||:.  ::.|.||:|.|
Mouse   371 GREE-LRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVRP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 87/359 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 90/364 (25%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.