DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and Serpina6

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:367 Identity:94/367 - (25%)
Similarity:180/367 - (49%) Gaps:34/367 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKN 72
            |..|:|  .|...||:..:..|...|.:.||:.:.:.::|:.:...|:|........|:  .|.:
Mouse    34 LAPTNV--DFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNM--SKMS 94

  Fly    73 VATIY------DKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADR 131
            .|.|:      :.||.:.:.|.:   :::.|.:|:.:.:.:...:......::.:||..|...|.
Mouse    95 EAEIHQGFQYLNSLLQQSDTGLE---MNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDW 156

  Fly   132 LKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKS 196
            .||...||:.|.::|...::.::  |||....:.::||..|.||.||..|...||:.:.|||:::
Mouse   157 TKAGEQINNHVKNKTQGKIEHVV--SDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNET 219

  Fly   197 YQVNVNMMSQVGRFK-MRTSTID-QIIELPFAYSNLSMVIVLPKDNGSLTQAEA-----TIESYP 254
            ..|.|.||.|.|... .|.|.|. |::::.:. .|.:..|:|| |.|.:....|     ||:.:.
Mouse   220 STVKVPMMVQSGNISYFRDSAIPCQMVQMNYV-GNGTTFIILP-DQGQMDTVVAALNRDTIDRWG 282

  Fly   255 QIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEI 319
            ::::.. .:::.:|||.:....:|.:.|..:||:|||.:.||.:.....:...:: |:|||.:::
Mouse   283 KLMIPR-QMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLT-VLHKAMLQL 345

  Fly   320 DEEGGSAGSASASPIRGLSDYATSVVTFTV--NSPFVFMIRD 359
            ||......:.:..|:...|:      :||:  |.||:|:..|
Mouse   346 DEGNVLPAATNGPPVHLPSE------SFTLKYNRPFIFLAFD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 91/359 (25%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 90/356 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.