DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Da and SERPINA3

DIOPT Version :9

Sequence 1:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:377 Identity:110/377 - (29%)
Similarity:173/377 - (45%) Gaps:33/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTAL--NLPE-DKKNVATIYD 78
            |...||:..:......|:|.|||.:...::.:.:||...|..|:...|  ||.| .:..:...:.
Human    56 FAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ 120

  Fly    79 KLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVL 143
            .||..|.:......|.:.|.:||.|.:.:..|:.:...:.:.:||.|....|...|...|||:|.
Human   121 HLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVK 185

  Fly   144 DQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVG 208
            :.|...:.|:|  .||......|::|..|||..|:..||..:|....||:||...|.|.|||   
Human   186 NGTRGKITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS--- 245

  Fly   209 RFKMRTSTI----DQ-----IIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEMDV- 263
               :...||    |:     ::||.:. .|.|.:.:|| |...:.:.||.:  .|:.:....|. 
Human   246 ---LHHLTIPYFRDEELSCTVVELKYT-GNASALFILP-DQDKMEEVEAML--LPETLKRWRDSL 303

  Fly   264 ------HVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEIDEE 322
                  .:.||||.|.....|.:.|..:||::.|.|.:|:|.:.......:|||||||.:::.||
Human   304 EFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEE 368

  Fly   323 GGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMI--RDDDNIYFRGRVVDP 372
            |..|.:|:|..|..||....:......|.||:.:|  .|..||:|..:|.:|
Human   369 GTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 108/372 (29%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 110/377 (29%)
RCL 369..394 7/24 (29%)
O-glycosylated at one site 381..389 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.