DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SME1

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_014802.3 Gene:SME1 / 854330 SGDID:S000005685 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:43/83 - (51%)
Similarity:59/83 - (71%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRN--- 72
            |.||.|||.||.:||.::.|.:||:|.|.:||:|.||||||:||:|:|:|.|:.|.:...:.   
Yeast     8 KAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVE 72

  Fly    73 ----LGRIMLKGDNITLI 86
                ||:|:|||||||||
Yeast    73 KGTPLGKILLKGDNITLI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 43/83 (52%)
SME1NP_014802.3 Sm_E 7..92 CDD:212465 43/83 (52%)

Return to query results.
Submit another query.