DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and LSM1

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_012411.1 Gene:LSM1 / 853318 SGDID:S000003660 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:50 Identity:15/50 - (30%)
Similarity:27/50 - (54%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FDEYMNLVLDD-AEEVYVKTRQR---RNLGRIMLKGDNITLIQNVSPTKD 94
            ||:|.||:|.| .|.:|.....:   .:.|..|::|:|:.::..|...|:
Yeast    71 FDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 13/42 (31%)
LSM1NP_012411.1 LSm1 40..115 CDD:212475 13/43 (30%)

Return to query results.
Submit another query.