DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SMX2

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_116636.1 Gene:SMX2 / 850528 SGDID:S000002965 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:68 Identity:18/68 - (26%)
Similarity:39/68 - (57%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVK-TRQRRNLG-RIMLKGDNIT 84
            :|:..:    :.|..|.|.::.|.:.|:|.::|:|||||.|:..: ......|| :.:::|::|.
Yeast     9 KYMDKK----ILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSII 69

  Fly    85 LIQ 87
            .::
Yeast    70 SLE 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 18/68 (26%)
SMX2NP_116636.1 Sm_G 3..75 CDD:212466 18/68 (26%)

Return to query results.
Submit another query.