DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SAD1

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_199698.1 Gene:SAD1 / 834945 AraportID:AT5G48870 Length:88 Species:Arabidopsis thaliana


Alignment Length:83 Identity:25/83 - (30%)
Similarity:42/83 - (50%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQR 70
            ||.    .:.|..||.|.:.::    :|:.......:.|.:.|||.|:|:||:|..|..:....|
plant     4 NPS----QLLPSELIDRCIGSK----IWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEITAEGR 60

  Fly    71 R--NLGRIMLKGDNITLI 86
            |  .|.:|:|.|:||.::
plant    61 RVTKLDQILLNGNNIAIL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 23/79 (29%)
SAD1NP_199698.1 LSm5 7..82 CDD:212479 23/76 (30%)

Return to query results.
Submit another query.