DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and LSM6A

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_191540.1 Gene:LSM6A / 825150 AraportID:AT3G59810 Length:91 Species:Arabidopsis thaliana


Alignment Length:91 Identity:21/91 - (23%)
Similarity:35/91 - (38%) Gaps:25/91 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVK 66
            |.:|.|.|.|:                        |..:...|.:...|.|||:.::..|| ||.
plant    21 SIRGRPVVVKL------------------------NSGVDYRGTLTCLDGYMNIAMEQTEE-YVN 60

  Fly    67 TRQRRNLGRIMLKGDNITLIQNVSPT 92
            .:.:...|...::|:|:..|..|:.|
plant    61 GQLKNKYGDAFIRGNNVLYISTVNMT 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 15/77 (19%)
LSM6ANP_191540.1 LSm6 14..81 CDD:212473 18/84 (21%)

Return to query results.
Submit another query.