DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SNRNP-G

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_179971.1 Gene:SNRNP-G / 816925 AraportID:AT2G23930 Length:80 Species:Arabidopsis thaliana


Alignment Length:91 Identity:22/91 - (24%)
Similarity:48/91 - (52%) Gaps:16/91 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYV 65
            ||..|.|...|          :|:..:.::::    |.:..:.|.:.|||::||||:|:..|  |
plant     1 MSRSGQPPDLK----------KYMDKKLQIKL----NANRMVTGTLRGFDQFMNLVVDNTVE--V 49

  Fly    66 KTRQRRNLGRIMLKGDNITLIQNVSP 91
            ....:.::|.::::|::|..::.:.|
plant    50 NGNDKTDIGMVVIRGNSIVTVEALEP 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 17/77 (22%)
SNRNP-GNP_179971.1 Sm_G 6..74 CDD:212466 18/83 (22%)

Return to query results.
Submit another query.