DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and AT2G18740

DIOPT Version :9

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_179464.1 Gene:AT2G18740 / 816389 AraportID:AT2G18740 Length:88 Species:Arabidopsis thaliana


Alignment Length:81 Identity:55/81 - (67%)
Similarity:69/81 - (85%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRN 72
            |||::|.||||||||:||:::|:|:||:|...|||||.|.|||||||||||:||||.:|...|:.
plant     5 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEVSIKKNTRKP 69

  Fly    73 LGRIMLKGDNITLIQN 88
            ||||:||||||||:.|
plant    70 LGRILLKGDNITLMMN 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 52/77 (68%)
AT2G18740NP_179464.1 Sm_E 7..85 CDD:212465 52/77 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2526
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37729
Inparanoid 1 1.050 121 1.000 Inparanoid score I1978
OMA 1 1.010 - - QHG53877
OrthoDB 1 1.010 - - D1594132at2759
OrthoFinder 1 1.000 - - FOG0002953
OrthoInspector 1 1.000 - - otm2970
orthoMCL 1 0.900 - - OOG6_102613
Panther 1 1.100 - - LDO PTHR11193
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2313
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.