DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and lsm6

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001165068.1 Gene:lsm6 / 779701 XenbaseID:XB-GENE-1007008 Length:80 Species:Xenopus tropicalis


Alignment Length:50 Identity:15/50 - (30%)
Similarity:25/50 - (50%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLI 86
            |..:...|.:...|.|||:.|:..|| ||..:.:...|...::|:|:..|
 Frog    25 NSGVDYRGVLACLDGYMNIALEQTEE-YVNGQLKNKYGDAFIRGNNVLYI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 14/49 (29%)
lsm6NP_001165068.1 LSm6 7..74 CDD:212473 14/49 (29%)

Return to query results.
Submit another query.