DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and LSM7

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_057283.1 Gene:LSM7 / 51690 HGNCID:20470 Length:103 Species:Homo sapiens


Alignment Length:67 Identity:20/67 - (29%)
Similarity:34/67 - (50%) Gaps:15/67 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YENISLRIE--------GHIVGFDEYMNLVLD-------DAEEVYVKTRQRRNLGRIMLKGDNIT 84
            |.:.::|::        |.:.|||..:|||||       |.::.|..|...|.||.::.:|.::.
Human    18 YIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVV 82

  Fly    85 LI 86
            ||
Human    83 LI 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 20/67 (30%)
LSM7NP_057283.1 LSm7 9..97 CDD:212476 20/67 (30%)

Return to query results.
Submit another query.