powered by:
Protein Alignment SmE and Lsm6
DIOPT Version :9
Sequence 1: | NP_609162.1 |
Gene: | SmE / 34080 |
FlyBaseID: | FBgn0261790 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038953847.1 |
Gene: | Lsm6 / 498934 |
RGDID: | 1561937 |
Length: | 98 |
Species: | Rattus norvegicus |
Alignment Length: | 46 |
Identity: | 14/46 - (30%) |
Similarity: | 23/46 - (50%) |
Gaps: | 1/46 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 NISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDN 82
|..:...|.:...|.|||:.|:..|| ||..:.:...|...::|:|
Rat 25 NSGVDYRGVLACLDGYMNIALEQTEE-YVNGQLKNKYGDAFIRGNN 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmE | NP_609162.1 |
Sm_E |
10..88 |
CDD:212465 |
14/46 (30%) |
Lsm6 | XP_038953847.1 |
LSm6 |
7..69 |
CDD:212473 |
13/44 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.