DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and snrpe

DIOPT Version :9

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001005147.1 Gene:snrpe / 448738 XenbaseID:XB-GENE-5922245 Length:92 Species:Xenopus tropicalis


Alignment Length:90 Identity:68/90 - (75%)
Similarity:83/90 - (92%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKG-NPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVY 64
            |:::| ..||||||||||||||||||||||:||||||.:::||||.|:|||||||||||||||::
 Frog     1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIH 65

  Fly    65 VKTRQRRNLGRIMLKGDNITLIQNV 89
            :||:.|:.|||||||||||||:|:|
 Frog    66 LKTKSRKQLGRIMLKGDNITLLQSV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 62/77 (81%)
snrpeNP_001005147.1 Sm_E 11..89 CDD:212465 62/77 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9248
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37729
Inparanoid 1 1.050 91 1.000 Inparanoid score I4964
OMA 1 1.010 - - QHG53877
OrthoDB 1 1.010 - - D1594132at2759
OrthoFinder 1 1.000 - - FOG0002953
OrthoInspector 1 1.000 - - oto103509
Panther 1 1.100 - - LDO PTHR11193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1273
SonicParanoid 1 1.000 - - X2313
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.