powered by:
Protein Alignment SmE and snrpd3l
DIOPT Version :9
Sequence 1: | NP_609162.1 |
Gene: | SmE / 34080 |
FlyBaseID: | FBgn0261790 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956054.1 |
Gene: | snrpd3l / 327011 |
ZFINID: | ZDB-GENE-030131-5219 |
Length: | 128 |
Species: | Danio rerio |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 22/51 - (43%) |
Gaps: | 16/51 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 EGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITL-IQNVSPT 92
|||||..: .:..||| .|:::...||:.. :.|::.|
Zfish 14 EGHIVTCE-------TNTGEVY--------RGKLIEAEDNMNCQMSNITVT 49
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmE | NP_609162.1 |
Sm_E |
10..88 |
CDD:212465 |
11/45 (24%) |
snrpd3l | NP_956054.1 |
Sm_D3 |
6..75 |
CDD:212468 |
13/51 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.