DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SNRPG

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_573139.1 Gene:SNRPG / 32636 FlyBaseID:FBgn0261791 Length:76 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:45/87 - (51%) Gaps:16/87 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYV 65
            ||....|:|:|           |:..|..:::    |....:.|.:.|||.:||:||||..| ..
  Fly     1 MSKAHPPEVKK-----------YMDKRMMLKL----NGGRAVTGILRGFDPFMNVVLDDTVE-EC 49

  Fly    66 KTRQRRNLGRIMLKGDNITLIQ 87
            |...:.|:|.::::|::|.:::
  Fly    50 KDNTKNNIGMVVIRGNSIVMVE 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 20/78 (26%)
SNRPGNP_573139.1 Sm_G 5..74 CDD:212466 22/83 (27%)

Return to query results.
Submit another query.