powered by:
Protein Alignment SmE and Sbat
DIOPT Version :9
Sequence 1: | NP_609162.1 |
Gene: | SmE / 34080 |
FlyBaseID: | FBgn0261790 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259971.1 |
Gene: | Sbat / 319043 |
FlyBaseID: | FBgn0051950 |
Length: | 121 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 36/71 - (50%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RSRVQVWLYENISLRI-EGHI-VGF----DEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITL 85
|.::|.||...:.:.| :|.: ||| |...|:||....|..|:.::.|.||.:|:.|.:|..
Fly 42 RRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEGQEPRLLGNVMVPGQHIVS 106
Fly 86 IQNVSP 91
:....|
Fly 107 LSIDEP 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmE | NP_609162.1 |
Sm_E |
10..88 |
CDD:212465 |
21/66 (32%) |
Sbat | NP_001259971.1 |
LSMD1 |
42..110 |
CDD:212486 |
21/67 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.