DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and Lsm5

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001100759.1 Gene:Lsm5 / 306222 RGDID:1308655 Length:91 Species:Rattus norvegicus


Alignment Length:83 Identity:24/83 - (28%)
Similarity:45/83 - (54%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQR 70
            ||.    .:.|:.|:.:.:.:|    :.:.......|.|.::|||:::|:||:|..|..:....|
  Rat     8 NPS----QLLPLELVDKCIGSR----IHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGR 64

  Fly    71 R--NLGRIMLKGDNITLI 86
            |  .|.:|:|.|:|||::
  Rat    65 RITKLDQILLNGNNITML 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 22/79 (28%)
Lsm5NP_001100759.1 LSm5 11..86 CDD:212479 22/76 (29%)

Return to query results.
Submit another query.