DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and sme1

DIOPT Version :9

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_595724.1 Gene:sme1 / 2539607 PomBaseID:SPBC11G11.06c Length:84 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:47/82 - (57%)
Similarity:62/82 - (75%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRN 72
            :|||||:.|||.||:.||..:.|.:||:|...:|::|.|.||||:||:|||||.:|..| ..:|.
pombe     4 RVQKVMIPPINFIFKLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQVDAK-NNKRE 67

  Fly    73 LGRIMLKGDNITLIQNV 89
            ||||:||||||||||.:
pombe    68 LGRILLKGDNITLIQAI 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 45/77 (58%)
sme1NP_595724.1 Sm_E 6..83 CDD:212465 45/77 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I2435
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37729
Inparanoid 1 1.050 99 1.000 Inparanoid score I1674
OMA 1 1.010 - - QHG53877
OrthoFinder 1 1.000 - - FOG0002953
OrthoInspector 1 1.000 - - oto101122
orthoMCL 1 0.900 - - OOG6_102613
Panther 1 1.100 - - LDO PTHR11193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1273
SonicParanoid 1 1.000 - - X2313
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.