DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and Snrpe

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_033253.1 Gene:Snrpe / 20643 MGIID:98346 Length:92 Species:Mus musculus


Alignment Length:91 Identity:69/91 - (75%)
Similarity:83/91 - (91%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKG-NPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVY 64
            |:::| ..||||||||||||||||||||||:||||||.:::||||.|:|||||||||||||||::
Mouse     1 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIH 65

  Fly    65 VKTRQRRNLGRIMLKGDNITLIQNVS 90
            .||:.|:.|||||||||||||:|:||
Mouse    66 SKTKSRKQLGRIMLKGDNITLLQSVS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 62/77 (81%)
SnrpeNP_033253.1 Sm_E 11..89 CDD:212465 62/77 (81%)

Return to query results.
Submit another query.