DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and lsm-6

DIOPT Version :9

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001379827.1 Gene:lsm-6 / 190601 WormBaseID:WBGene00003080 Length:77 Species:Caenorhabditis elegans


Alignment Length:88 Identity:24/88 - (27%)
Similarity:39/88 - (44%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKGNPK--VQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEV 63
            ||.:.||.  ::||:.:|             |.|.|...:..|  |.:...|.|||:.|:..|| 
 Worm     1 MSKRQNPAEFLKKVIGKP-------------VVVKLNSGVDYR--GILACLDGYMNIALEQTEE- 49

  Fly    64 YVKTRQRRNLGRIMLKGDNITLI 86
            |...:.:...|...::|:|:..|
 Worm    50 YSNGQLQNKYGDAFIRGNNVLYI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 20/77 (26%)
lsm-6NP_001379827.1 LSm6 6..73 CDD:212473 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.