DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SmF

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:XP_061507398.1 Gene:SmF / 1273301 VectorBaseID:AGAMI1_002233 Length:88 Species:Anopheles gambiae


Alignment Length:57 Identity:16/57 - (28%)
Similarity:32/57 - (56%) Gaps:6/57 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WLYENISLRIEGHIVGFDEYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQNV 89
            |.:|     .:|.:|..|.|||:.|.:.|| :|..:...:||.::::.:|:..|:.:
Mosquito    27 WGHE-----YKGFLVSVDGYMNMQLANTEE-FVDGQNTGHLGEVLIRCNNVLYIRGI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 16/54 (30%)
SmFXP_061507398.1 None

Return to query results.
Submit another query.