DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and SmE

DIOPT Version :10

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:XP_311506.3 Gene:SmE / 1272597 VectorBaseID:AGAMI1_011661 Length:90 Species:Anopheles gambiae


Alignment Length:89 Identity:77/89 - (86%)
Similarity:81/89 - (91%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVYV 65
            |||||: ||||||||||||||||||||||||||||||..|||||||||||||||||||:|||..:
Mosquito     1 MSFKGS-KVQKVMVQPINLIFRYLQNRSRVQVWLYENTHLRIEGHIVGFDEYMNLVLDEAEEFNI 64

  Fly    66 KTRQRRNLGRIMLKGDNITLIQNV 89
            |.:.||.|||||||||||||||||
Mosquito    65 KKQTRRQLGRIMLKGDNITLIQNV 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 67/77 (87%)
SmEXP_311506.3 Sm_E 9..87 CDD:212465 67/77 (87%)

Return to query results.
Submit another query.