DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmE and Snrpep2

DIOPT Version :9

Sequence 1:NP_609162.1 Gene:SmE / 34080 FlyBaseID:FBgn0261790 Length:94 Species:Drosophila melanogaster
Sequence 2:XP_038956972.1 Gene:Snrpep2 / 100362099 RGDID:2318883 Length:92 Species:Rattus norvegicus


Alignment Length:91 Identity:68/91 - (74%)
Similarity:82/91 - (90%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFKG-NPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEEVY 64
            |.::| ..||||||||||||||||||||||:||||||.::::|||.|:|||||||||||||||::
  Rat     1 MEYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMQIEGCIIGFDEYMNLVLDDAEEIH 65

  Fly    65 VKTRQRRNLGRIMLKGDNITLIQNVS 90
            .||:.|:.|||||||||||||:|:||
  Rat    66 SKTKSRKQLGRIMLKGDNITLLQSVS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmENP_609162.1 Sm_E 10..88 CDD:212465 61/77 (79%)
Snrpep2XP_038956972.1 Sm_E 11..89 CDD:212465 61/77 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339782
Domainoid 1 1.000 111 1.000 Domainoid score I6114
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4372
OMA 1 1.010 - - QHG53877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002953
OrthoInspector 1 1.000 - - otm45308
orthoMCL 1 0.900 - - OOG6_102613
Panther 1 1.100 - - O PTHR11193
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2313
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.