DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7102 and ifi44d

DIOPT Version :10

Sequence 1:NP_787994.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001373548.1 Gene:ifi44d / 795887 ZFINID:ZDB-GENE-200128-2 Length:287 Species:Danio rerio


Alignment Length:105 Identity:28/105 - (26%)
Similarity:41/105 - (39%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HVN-PELFRQFILYVYTAKLVLQDSQVFQMMILAQDIGVVE----LRTACE----DHVISTLSVD 134
            :|| |.|..|....||..     |::..|.:    |.|:::    :|.|..    ..||....||
Zfish   154 YVNDPSLSNQAFCLVYVV-----DAKTVQYI----DQGLIDKLKIIRHAISHDRIPQVIVMTKVD 209

  Fly   135 NACTFLTAVMDIHEKAGAKCAASFMERCIIYIGENANECV 174
            .||..:..  |:.:...:|.....||.|...||...| |:
Zfish   210 EACPLVKE--DLRKIYTSKKIKEKMEMCSEAIGVPVN-CI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7102NP_787994.1 BTB_POZ_ZBTB_KLHL-like 20..112 CDD:349497 9/33 (27%)
BACK 143..255 CDD:197943 9/32 (28%)
TLDc 303..477 CDD:214733
ifi44dNP_001373548.1 YeeP 26..>249 CDD:442815 28/105 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.