DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7102 and ifi44f4

DIOPT Version :10

Sequence 1:NP_787994.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001373754.1 Gene:ifi44f4 / 571377 ZFINID:ZDB-GENE-030131-4763 Length:459 Species:Danio rerio


Alignment Length:103 Identity:33/103 - (32%)
Similarity:51/103 - (49%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 VGKQSWRLVFRASTHGYDSGAFHRYCDGVAPCMVIGLGSHGEISGGYTDVAWAKTSRKGGYVQSE 387
            :|.....|:::||.|||.:.|||:.||...|.:::.....|.|.||||.|.:.::.|:   ::.:
Zfish    30 LGDVDLTLLYKASVHGYKASAFHQRCDHQGPTILVAYNRSGYIFGGYTSVDYTQSGRE---IKDD 91

  Fly   388 RAFLFALNPANGEQPVKFDIVKKPYAICYHPDCGPIFG 425
            .||||:.:..|.    .|..|...|...|.....|.||
Zfish    92 EAFLFSFHGGNS----SFIKVNSGYNARYDDSGAPNFG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7102NP_787994.1 BTB_POZ_ZBTB_KLHL-like 20..112 CDD:349497
BACK 143..255 CDD:197943
TLDc 303..477 CDD:214733 33/103 (32%)
ifi44f4NP_001373754.1 TLD 37..156 CDD:429519 32/96 (33%)
Ras_like_GTPase 217..404 CDD:206648
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.