DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7102 and si:ch211-197g15.9

DIOPT Version :10

Sequence 1:NP_787994.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_021325263.1 Gene:si:ch211-197g15.9 / 555440 ZFINID:ZDB-GENE-050208-616 Length:452 Species:Danio rerio


Alignment Length:169 Identity:44/169 - (26%)
Similarity:74/169 - (43%) Gaps:49/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 VGKQSWRLVFRASTHGYDSGAFHRYCDGVAPCMVIGLGSHGEISGGYTDVAWAKTSRKGGYVQSE 387
            :|.....|:::||.|||::.|||:.||...|.:::...|.|.|.||||.|.:   ::.|.|:..|
Zfish    30 LGDVDLTLLYKASVHGYNASAFHQRCDRQGPTLLVAYNSSGYIFGGYTSVDF---TQSGQYIADE 91

  Fly   388 RAFLFALNPANGEQPVKFDIVKKPYAICYHPDCGPIFGAGADLLISSNCNTNMDS---------- 442
            ..|||..   .|:.||                |         :.::|..|..:|.          
Zfish    92 DIFLFCF---QGKIPV----------------C---------MKLNSGYNARLDDTGVPSFGQQL 128

  Fly   443 ---YSNLPHSYD-GTNAAHLT---LFGDYNFTITDYEVY 474
               |:|.|..|: |.:|..:.   ::|: :..:::.|||
Zfish   129 YFCYNNQPMVYNQGVSAFTVNTAIMYGN-DTQLSECEVY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7102NP_787994.1 BTB_POZ_ZBTB_KLHL-like 20..112 CDD:349497
BACK 143..255 CDD:197943
TLDc 303..477 CDD:214733 44/169 (26%)
si:ch211-197g15.9XP_021325263.1 TLD 37..>102 CDD:445683 27/70 (39%)
Ras_like_GTPase 216..403 CDD:206648
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.