DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7102 and CG11714

DIOPT Version :10

Sequence 1:NP_787994.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster


Alignment Length:85 Identity:20/85 - (23%)
Similarity:29/85 - (34%) Gaps:21/85 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLQRLSEDQDSADVVFICGRDERIYAHRLMLMARCKSFKTAKRGEVCRIPGCTVSPAAPGASTPT 73
            |...:.||:......|.|        |:|:.......|.....|:...             ||..
  Fly    29 DCTFIIEDESGGSQSFPC--------HKLLFSCASDVFDRMLYGDYIE-------------STSG 72

  Fly    74 TIRLPHVNPELFRQFILYVY 93
            .:||..|.|::|.:|..|||
  Fly    73 VVRLNDVQPDIFEKFRDYVY 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7102NP_787994.1 BTB_POZ_ZBTB_KLHL-like 20..112 CDD:349497 17/74 (23%)
BACK 143..255 CDD:197943
TLDc 303..477 CDD:214733
CG11714NP_001027123.1 BTB_POZ_ZBTB_KLHL-like 27..117 CDD:349497 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.