DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7102 and ifi44a1

DIOPT Version :10

Sequence 1:NP_787994.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_009304423.1 Gene:ifi44a1 / 100148554 ZFINID:ZDB-GENE-090312-156 Length:294 Species:Danio rerio


Alignment Length:159 Identity:33/159 - (20%)
Similarity:54/159 - (33%) Gaps:50/159 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 ANKMMDN-----DKRLQPRLAVAVNMFPGSQILKNDNLALQTVLNNWVGVGKQSWRLVFRASTHG 338
            ::|.:|.     |...:.||...:..|   |:...|...::.::...:|.||.|:.....::..|
Zfish    14 SSKKLDKPWRNFDWEQKDRLKERLEKF---QLSSPDLNCVKLLVAGQIGAGKSSFINSVNSAFQG 75

  Fly   339 Y---------DSGAFHRY--------------------CD--GVAPCMVIGLGS-------HGEI 365
            .         .|.|.|.|                    ||  |:.|..:.||..       ||.:
Zfish    76 QIVCDAQADAQSAASHSYTKKLEGYRIKNADADLPFEICDVMGLEPQELSGLQPEDVVKIIHGHV 140

  Fly   366 SGGYTDVAWAKTSRKGGYVQ----SERAF 390
            ..||.......||:...|.:    |::||
Zfish   141 KEGYKFTENPITSKSESYNEIPSLSDQAF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7102NP_787994.1 BTB_POZ_ZBTB_KLHL-like 20..112 CDD:349497
BACK 143..255 CDD:197943
TLDc 303..477 CDD:214733 27/130 (21%)
ifi44a1XP_009304423.1 YeeP 28..>289 CDD:442815 30/145 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.