DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz3 and MRPS17

DIOPT Version :9

Sequence 1:NP_609160.2 Gene:spz3 / 34077 FlyBaseID:FBgn0031959 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_013913.1 Gene:MRPS17 / 855226 SGDID:S000004800 Length:237 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:31/161 - (19%)
Similarity:58/161 - (36%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 YDVEEGEEDEEEDGEEEGQFYEGQENDKSNNNQMPT----VTPIQGPIYLKNGTVPVVPLFSYPK 348
            |:.|......:|:.::..:|.:.:...::..|:..|    :..||..  |.:|:.|...|....:
Yeast    88 YESEAQLSVAKEEAQKAKEFLDKRSVRENKLNEKTTLLRDIRTIQDA--LSSGSTPKELLEIKQR 150

  Fly   349 LNNGSFLQIPIWWTALSVALGLDVRG---DVIKGVPCIKRYHQLFCPTAGNSYPIDKIERFIDDN 410
            .....|.|     ..:...|.||:.|   ::.|....|.|..........|..   |.::|:.|:
Yeast   151 YGIQDFSQ-----ETVRQLLQLDISGLEVNLEKQRSLIDRIQTRLSELLSNDL---KCDQFLKDH 207

  Fly   411 -------------KALMRRMYGDFEMNMEGP 428
                         |.|:|:   ...|:|:.|
Yeast   208 GVEDPLTLKKNIKKNLLRK---HVMMDMQQP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz3NP_609160.2 Spaetzle 520..607 CDD:292695
MRPS17NP_013913.1 RpsQ 1..83 CDD:223264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12692
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.