DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz3 and NT1

DIOPT Version :9

Sequence 1:NP_609160.2 Gene:spz3 / 34077 FlyBaseID:FBgn0031959 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001261417.1 Gene:NT1 / 38558 FlyBaseID:FBgn0261526 Length:1042 Species:Drosophila melanogaster


Alignment Length:562 Identity:112/562 - (19%)
Similarity:182/562 - (32%) Gaps:208/562 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NSVYHIQQVQQTQQQQTQQQHQQQDQHENSVSFQSSSSRSSSSSTTGQSSIQLTQTHASGRGPAE 162
            :::|| ..:.:.:...|.::.||.|| ..:::.:....:.|:      ..:||..        .|
  Fly   192 SALYH-TPINRREDDLTPEESQQDDQ-LGTIAVEVEPKKVST------EEVQLES--------LE 240

  Fly   163 GSYSRYPGQQAQPPQQQQPQQKQYFNAHGSASATF-TKNSGSFSITSFGSRQQQQQPPQPQQPPP 226
            ..:.....:...|   |...:....:.|.:.:.|| .:|.|                        
  Fly   241 DFFDEMGSEVLDP---QMINEALTGDLHDNKTKTFKPENHG------------------------ 278

  Fly   227 SQQQQPPPAPPPQRSRQAKPEAQPAQTYGVAPPENYPERAPGFTRVQAGQGSRTQVHAVLDYDVE 291
                        ||.|::..|.....|..|  |.:..|:     ::..|...||.......:...
  Fly   279 ------------QRVRRSANEFVHKLTRSV--PASVTEQ-----QLLGGIAGRTIKLNTTAFQQP 324

  Fly   292 EGEEDEEEDGEEEGQFYEGQEN-------------------DKSNNNQMPTVTP-------IQGP 330
            ..:|:|:......||.|...|:                   |...|:...|..|       |.||
  Fly   325 SSQEEEKMASSNGGQSYSEVEDLAFAGLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGP 389

  Fly   331 IYLKNGTVPVVPLFSYPKLNNGSFLQIPIWWTALSVALGLDVRGDVIKGVPCIKRYHQLFCPTAG 395
            .| :.|..|:      |...:||    ||....::.:|         :|.|          .||.
  Fly   390 RY-RLGKRPL------PGQKSGS----PIKRKRVTSSL---------RGRP----------KTAA 424

  Fly   396 NSY------PIDKIERFIDDNKALMRRMYGDFEMNMEGPGGGGGRQQGKVRKRR---------FI 445
            :|:      |..|.|||..:    |.....|:.:.         :..|.:|:.:         |.
  Fly   425 SSHKPVVTPPNKKCERFTSN----MCIRTDDYPLE---------QIMGSIRRHKNAMSALLAEFY 476

  Fly   446 DEPDIFIPPGAFAANAGETVEAGDSYFG-QLRKKRQAAAGGSRNRGGSAGGSGNGNTNANRQPGN 509
            |:|:             ..:|..|.:.. .|.|||       |...|||||              
  Fly   477 DKPN-------------NNLEFSDDFDDFSLSKKR-------REDEGSAGG-------------- 507

  Fly   510 KNGSSGTGRLDACESKIEIVTPYWASNSAGKIRAIVNTQHFEQAIHQEVCSN--------TQTPR 566
                       .|:|.:....|..|.:::|:.:.||||....|.:..|.|||        .||.|
  Fly   508 -----------MCQSVVRYARPQKAKSASGEWKYIVNTGQHTQTLRLEKCSNPVESCSYLAQTYR 561

  Fly   567 CEGECGCEQKYKWHRLLAYDPDNDCKGIFMDWFLFPSCCVCR 608
            ..    |.|.|.:||||::|   ..:|:.:|.|..|:||.|:
  Fly   562 SH----CSQVYNYHRLLSWD---KVRGLHVDIFKVPTCCSCQ 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz3NP_609160.2 Spaetzle 520..607 CDD:292695 31/94 (33%)
NT1NP_001261417.1 Spaetzle 508..595 CDD:292695 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.