DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz3 and spz6

DIOPT Version :9

Sequence 1:NP_609160.2 Gene:spz3 / 34077 FlyBaseID:FBgn0031959 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_611961.1 Gene:spz6 / 37956 FlyBaseID:FBgn0035056 Length:425 Species:Drosophila melanogaster


Alignment Length:508 Identity:98/508 - (19%)
Similarity:149/508 - (29%) Gaps:221/508 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ITSFGSRQQQQQPPQ---PQQPPPSQQQ--QPPPAPPPQRSRQAKPEAQPAQTYGVAPPENYPER 265
            :...|..|.|||.|.   .:|||.....  :.|.|.||    :.:|   |..|:..|..::    
  Fly    15 LAQLGFSQPQQQSPSDYGEEQPPEGYYAFVESPNAVPP----KVRP---PPYTFVNAECKD---- 68

  Fly   266 APGFTRVQAGQGSRTQVHAVLDYDVEEGEEDEEEDGEEEGQFYEGQENDKSNNNQMPTVTPIQGP 330
                  |.||:.|...||.:.. |:.:|:..:...|:                |.:....|.:  
  Fly    69 ------VAAGKKSAVSVHNICG-DLNKGQIPKNPLGQ----------------NVLGEPYPFE-- 108

  Fly   331 IYLKNGTVPVVPLFSYPKLNNGSFLQIPIWWTALSVALGLDVRGDVIKGVPCIKRYHQLFCPTAG 395
             .::|.|:              .||.                     |.:|.:|         |.
  Fly   109 -LIRNQTL--------------KFLS---------------------KTLPVLK---------AD 128

  Fly   396 NSYPIDKIERFIDDNKALMRRMYGDFEMNMEGPGGGGGRQQGKVRKRRFIDEPDIFIPPGAFAAN 460
            ::.|  |:.:.|.|..  :.::..:   |::.|...|    |..|.||       .:|.|     
  Fly   129 DTLP--KVTQIIRDEP--VEQLDSN---NIDRPYPAG----GSTRVRR-------SLPEG----- 170

  Fly   461 AGETVEAGD-SYF----------------------GQLRKKRQAAAGGS------RNRGGSAGGS 496
                ||:.: |||                      .:.||.|:...||.      |...|..||:
  Fly   171 ----VESNEYSYFDPALDEEEQHKQRDRNNQQRRAAEERKPRKFCDGGGVFCTLYRAIQGDTGGA 231

  Fly   497 GNGNTNANRQPGNKNGSSGTGRLDA----CESKIEIVTPYWASNSAGKIRAIVNTQ---HFEQAI 554
            ......|.|:.     ..|..|.:.    |.:|:|..||.:|.|..|..|.:|...   :|.|.:
  Fly   232 APATPTAERRE-----EVGPIRYEGPPTPCPAKVEYATPVFAKNYQGAWRYVVQIPYEGYFTQTV 291

  Fly   555 HQEVCSNTQTPRCEGECGCEQKYKWHRLL-----------------------------AYDP--- 587
            ....|...:....:|  ||....:|..||                             ||..   
  Fly   292 EVTRCIQARCHYLDG--GCLSSPRWVSLLVAEIFYPNAEDTVPTSSTTTQAPSVQDFQAYQQYLQ 354

  Fly   588 -----------------------DNDCKG----------IFMDWFLFPSCCVC 607
                                   |..|.|          ::.||||.|..|.|
  Fly   355 KRAGVATASDGTSSGAAGPAAQVDAHCDGHDELGCFQVRLYYDWFLIPGSCKC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz3NP_609160.2 Spaetzle 520..607 CDD:292695 30/158 (19%)
spz6NP_611961.1 Spaetzle 256..407 CDD:292695 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.