DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and TwdlT

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:180 Identity:88/180 - (48%)
Similarity:102/180 - (56%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAPSPPV 104
            |..||:|...   |......::.||:||||||||.|....|..|.:...||||||:||||||||.
  Fly   113 GSIGGFGGGG---GGGGGTTLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPS 174

  Fly   105 PTAPVIPQFPQNEEKTLVYVLVKKPEEQPEIIIPTPAPTQPSKPEVYFIRYKTQKEE-------- 161
            ..|||||..|||||||||||||||||:|.:|:|||||||||||||||||:|||||:.        
  Fly   175 YQAPVIPLQPQNEEKTLVYVLVKKPEDQQDIVIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGIS 239

  Fly   162 -----------------------TGPYPNSVAPPAPEYGAPAAPPAPSAP 188
                                   ||....|::.|:..||    ||..|.|
  Fly   240 GSTGGFTQTNTGNGYTSGGDGGFTGGDSGSISAPSSNYG----PPGKSGP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 70/98 (71%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 68/92 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AX5Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.