DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlE and Tb

DIOPT Version :9

Sequence 1:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:84/216 - (38%) Gaps:70/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPRKPLYVPPP-QKHYKIVFIKAP-S 101
            ||...| |:.:..|.|....  .:|..:.: ..||.:::..:....:... :|:.::|||:|| :
  Fly    69 SGSLSG-GSYSTNYAPVNTE--FNKEFFTY-SAPEADFEDNKSVSDLAATLKKNLRVVFIRAPEN 129

  Fly   102 PPVPTAPVIPQFPQNEEKTLVYVLVKKPE-----EQPEIIIPTPAPTQPSKPEVYFIRYKTQK-- 159
            ..:..|.:.......|::|.:|||.|:.:     .|.:.:....|    |||||:|::|:||:  
  Fly   130 KGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSA----SKPEVHFVKYRTQQDA 190

  Fly   160 -----------EETG----PYPNSVAP-----------------------------------PAP 174
                       |..|    .|...|||                                   .:.
  Fly   191 INAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSA 255

  Fly   175 EYGAPAA---PPAPSAPSSSY 192
            |..||:|   ||..:|||::|
  Fly   256 ELEAPSAGYIPPPAAAPSATY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlENP_609157.3 DM5 59..158 CDD:214776 25/105 (24%)
TbNP_651494.1 DM5 86..187 CDD:214776 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.